close
    Sign in to get AI-powered answers to your questions.
    What is BigQuery?

    BigQuery is a fully managed enterprise data warehouse that helps you manage and analyze your data with built-in features like machine learning, geospatial analysis, and business intelligence.

    It is a serverless and cost-effective data warehouse that works across clouds and scales with your data. You can use built-in ML/AI and BI for insights at scale.

    gcloud beta services api-keys describe | Google Cloud SDK
    sdkgcloudreferencebetaservicesapi-keysdescribe
    gcloud beta services api-keys describe | Google Cloud SDKSkip to main contentTechnology areasMoreOverviewGuidesReferenceResourcesCross-product ...
    Cloud API Registry
    productsapi-registrypricing
    Cloud API Registry pricing Cloud API Registry is offered at no charge. Request a custom quote With Google Cloud's pay-as-you-go pricing, you only pay for ...
    Creating World-Class Developer Experiences
    filesapigeeinside-api-product-mindset.pdf
    API is available for anyone to consume, e.g., a branch locator API.Enterprises typically use public APIs to either monetize valuable proprietary services that ...
    gcloud alpha services api-keys lookup | Google Cloud SDK
    sdkgcloudreferencealphaservicesapi-keyslookup
    gcloud alpha services api-keys lookup | Google Cloud SDKSkip to main contentTechnology areasMoreOverviewGuidesReferenceResourcesCross-product ...
    Cloud Domains API v1beta1 - Package cloud.google.com/go/domains/apiv1beta1 (v0.10.7) | Go client libraries | Google Cloud Documentation
    godocsreferencecloud.google.comgodomainslatestapiv1beta1
    ... API. Enables management and configuration of domain names. See more code actions. Dismiss View Light code theme Dark code theme NOTE: This package is in ...
    Cloud Domains API – APIs and services – Google Cloud console
    apislibrarydomains.googleapis.com
    Cloud domains API Google Easy domain registration and management Enable Try this API Overview Documentation Related products Overview Cloud Domains enables ...
    APIs and Reference | Recommender
    recommenderdocsapis
    ... API. RPC API Reference documentation for Recommender RPC API. Recommenders Overview and reference documentation for available recommenders. Insights ...
    Cloud Domains v1 API - Class DomainsClientImpl (2.4.0) | .NET client library
    dotnetdocsreferenceGoogle.Cloud.Domains.V1latestGoogle.Cloud.Domains.V1.DomainsClientImpl
    ... API class DomainsClientImpl. Domains client wrapper implementation, for convenient use. Inheritance object > DomainsClient > DomainsClientImpl Inherited ...
    Complimentary 2025 Gartner® Magic Quadrant ™ for API Management Report
    resourcescontent2025-gartner-mq-apim
    ... API management is evolving to drive organizational growth and AI development ... API Management for the tenth consecutive time. API MQ *Disclaimer ...
    Discover Address Validation - Google Maps Platform
    intlzh-CN-cnmaps-productsaddress-validation
    lets you validate and correct address inputs with Places data powered by Google Maps Platform. 开始使用 API stucka Verify address existence Help ensure address ...
    Enum GetSubnetworkRequest.Views (1.86.0) | Java client library
    javadocsreferencegoogle-cloud-computelatestcom.google.cloud.compute.v1.GetSubnetworkRequest.Views
    ... api-clientgoogle-area120-tablesgoogle-auth-librarygoogle-cloud-accessapprovalgoogle-cloud-advisorynotificationsgoogle-cloud-aiplatformgoogle-cloud ...
    gcloud alpha domains registrations operations list | Google Cloud SDK
    sdkgcloudreferencealphadomainsregistrationsoperationslist
    ... iam-policy-bindingcreatedeletedescribeget-iam-policylistremove-iam-policy-bindingupdategatewaysOverviewadd-iam-policy-bindingcreatedeletedescribeget-iam ...
    Qwen3-Next Thinking API Service – Vertex AI – Google Cloud console
    vertex-aipublishersqwenmodel-gardenqwen3-next-80b-a3b-thinking-maas
    Qwen3-Next Thinking API service Qwen3-Next Thinking API Service Access the Qwen3-Next Thinking model as a fully managed Vertex AI service Overview Use cases ...
    Cloud Optimization API – Marketplace – Google Cloud console
    marketplaceproductgooglecloudoptimization.googleapis.com
    ... API provides a portfolio of solvers to address common optimization use cases starting with optimal route planning for vehicle fleets. Learn more About ...
    gcloud domains registrations update | Google Cloud SDK
    sdkgcloudreferencedomainsregistrationsupdate
    Service Directory API v1 - Package cloud.google.com/go/servicedirectory/apiv1 (v1.12.7) | Go client libraries | Google Cloud Documentation
    godocsreferencecloud.google.comgoservicedirectorylatestapiv1
    ... API. Service Directory is a platform for discovering, publishing, and connecting services. General documentation For information that is relevant for all ...
    Cloud Domains API – Marketplace – Google Cloud console
    marketplaceproductgoogledomains.googleapis.com
    Cloud domains API Google Easy domain registration and management Enable Try this API Overview Documentation Overview Cloud Domains enables users to search ...
    Package google.cloud.vision.v1 | Vision API Product Search
    visionproduct-searchdocsreferencerpcgoogle.cloud.vision.v1
    ... API detection tasks over client images, such as face, landmark, logo, label, and text detection. The ImageAnnotator service returns detected entities from ...
    Custom Search API – APIs and services – Google Cloud console
    apislibrarycustomsearch.googleapis.com
    ... API Overview Pricing Documentation Support Related products Overview The JSON Custom Search API lets you develop websites and applications to retrieve and ...
    gcloud app domain-mappings | Google Cloud SDK
    sdkgcloudreferenceappdomain-mappings
    Google Cloud
    send_spark
      DocsSupport
      Console
      Sign in
      • Accelerate your digital transformation
      • Whether your business is early in its journey or well on its way to digital transformation, Google Cloud can help solve your toughest challenges.
      • Google Cloud products
      • Browse over 100 products. New customers get $300 in free credits to run, test, and deploy workloads. All customers can use 25+ products for free, up to monthly usage limits.
      • Save money with our transparent approach to pricing
      • Google Cloud's pay-as-you-go pricing offers automatic savings based on monthly usage and discounted rates for prepaid resources. Contact us today to get a quote.
      Google Cloud